Oncolytic Virus Solutions
Pre-Made AAVs Center
Neuronal Tracing Tool

BrainVTA

Construction and Packaging Service of virus Vector

Construction and Packaging Services of AAV

Large scale AAV production

TPO protein (Human)

Recombinant Human Yhyoid Peroxidase/TPO protein (His tag)


Thyroid peroxidase, also called thyroperoxidase (TPO) or iodide peroxidase that with  100 kDa molecular weight, plays a key role in the thyroid hormone biosynthesis by catalysing both the iodination of tyrosyl residues and the coupling of iodotyrosyl residues in thyroglobulin (TG) to form precursors of the thyroid hormones T4 and T3.
 
Recombinant Human Thyroid Peroxidase/TPO protein (His tag) is a Human Fragment protein expressed in Baculovirus-Insect cells, in 19 to 846 aa range, and suitable for SDS-PAGE, Positive Control, WB and antigens in the thyroid peroxidase antibody detection kit.


Product Description

Specifications

Product Name Recombinant Thyroid Peroxidase (TPO)
Species Human
Cat  Number TPO-P001
Protein ID P07202
Tag N-terminal His Tag
Expression System Baculovirus-Insect cells
Subcellular Location Membrane
Buffer 20 mM HEPES, 160 mM NaCl, 0.08 mM KI, 20% Glycerol, pH 7.6
Purity > 95%, determined by SDS-PAGE
Concentration 350µg/mL(Elisa)
Endotoxin < 1.0 EU/ μg, determined by LAL
Biologically active > 200U/mg


Amino acid sequence

FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLK
TQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASN TALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHDIAFTPQSTSKAAFGGGA
DCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGDQGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWT
SAEGLLRVHARLRDSGRAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAALKALNAHWSADA
VYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQA
FFSPWTLLRGGGLDPLIRGLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLST
AIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQMKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTG
LTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEG
WDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGRLPR

Application

SDS-PAGE, Positive Control, Immunogen(thyroid peroxidase antibody detection kit), WB and other research.

Why choose BrainVTA

  • Good immunogenicity and similar function to native protein.
  • High biological activity and high sensitivity
  • Patent One-bac4.0 systerm, easy to scale-up and keep batch stable.


Images




 
Shipping& Storage
Recombinant proteins can be shipped as lyophilized powder at ambient temperature or as frozen liquid with blue ice.
Samples are stable for up to twelve months at -20℃ to -80℃, and 2℃-8℃ for 2-4 weeks.void repeated freeze-thaw cycles.


References
1. McLachlan SM, et al. (2000) Autoimmune response to the thyroid in humans: thyroid peroxidase--the common autoantigenic denominator. Int Rev Immunol. 19(6):587-618.
2. Nagasaka A, et al. (1976) Effect of antithyroid agents 6-propyl-2-thiouracil and 1-mehtyl-2-mercaptoimidazole on human thyroid iodine peroxidase. J Clin Endocrinol Metab. 43(1): 152-8.
3. Kimura S, et al. (1987) Human thyroid peroxidase: complete cDNA and protein sequence, chromosome mapping, and identification of two alternately spliced mRNAs. Proc Natl Acad. 84(16):5555-9.
4. Ruf J, et al. (2006) Structural and functional aspects of thyroid peroxidase. Arch Biochem Biophys. 445 (2):269-77.


50% discount for Pre-Made AAVs